PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0321s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family MYB
Protein Properties Length: 465aa    MW: 51671.5 Da    PI: 7.7224
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0321s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.33.1e-171461148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
         Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                            +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
  SapurV1A.0321s0070.1.p 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                            678*******************************************97 PP

2Myb_DNA-binding44.82.9e-1467110146
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
         Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                             rg ++++E+ l++d+++ lG++ W+ Ia+ ++ gRt++++k+ w++
  SapurV1A.0321s0070.1.p  67 RGTFSQQEENLIIDLHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                             899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.116965IPR017930Myb domain
SuperFamilySSF466896.36E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002493.5E-151461IPR001005SANT/Myb domain
CDDcd001674.23E-121761No hitNo description
Gene3DG3DSA:1.10.10.604.9E-2565116IPR009057Homeodomain-like
SMARTSM007171.6E-1266114IPR001005SANT/Myb domain
PROSITE profilePS5129420.05766116IPR017930Myb domain
PfamPF002497.6E-1367111IPR001005SANT/Myb domain
CDDcd001676.94E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQQEENLIID LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQKG  120
IDPVTHKPLS EVVNGENKNS PASGTQDKAS AVSCTELNLL RAENSKSPGA NLQEKGSSPI  180
SPNGFQLERE STSSSRVMNG NGNNTNEQGN NNLMTPTSNK DFFLDRFTAP HHQGSTSNCQ  240
PSDFVGHFPL QQLNYASNAR LATNSIPSPW LSQASKAFDM NSEFSSTVIP SILPPVVTSS  300
FLSTSMGYRP SITAPPDNPP LPSFASNSCR LWETDAPRNN SNSSTGSNGS TELQSNSSFF  360
ENTMFSWGLG DCSSSEKEAQ NHLMESQHED IKWPEYLQNP LLMAAALQNQ NQQSLYSEIK  420
PETHLLTENS SGMWPHNQHQ QQPLQDPDIC PKDMQRITAS FGYI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-28121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB9707840.0AB970784.1 Populus nigra PniMYB055 mRNA for MYB transcriptional factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002320929.10.0hypothetical protein POPTR_0014s10680g
TrEMBLB9I9970.0B9I997_POPTR; Uncharacterized protein
STRINGPOPTR_0014s10680.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.16e-94myb domain protein 61